SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005099 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005099
Domain Number - Region: 86-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0129
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005099   Gene: ENSMPUG00000005135   Transcript: ENSMPUT00000005184
Sequence length 250
Comment pep:novel scaffold:MusPutFur1.0:GL896982.1:7059629:7068967:1 gene:ENSMPUG00000005135 transcript:ENSMPUT00000005184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKKAELKKTSLSKSYKAVCLELKPEPTKVRSFFEAMPTARPETRGEVTWSQGSFAVPG
GQDLSQTYDYKGVKQEGPFTKAGGTHELRNELREVREELKEKMDEIKQIKGVMDKDFDKL
QEFVEIMKEMQKDMDEKMDVLMNIQKNSKLPLRRGPKEQQELRLIGKTDPDPQLCLKKMD
GADGTPLSLHKKMMALQKPKKDPLDALHQCGPCCEKCLLCALKNNYNQGSRKLPYQAWPP
CSSLASGAAF
Download sequence
Identical sequences M3Y198
ENSMPUP00000005099 ENSMPUP00000005099 XP_004762037.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]