SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005146 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005146
Domain Number 1 Region: 199-344
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-26
Family First domain of FERM 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005146   Gene: ENSMPUG00000005183   Transcript: ENSMPUT00000005233
Sequence length 586
Comment pep:novel scaffold:MusPutFur1.0:GL897057.1:2947861:2994470:1 gene:ENSMPUG00000005183 transcript:ENSMPUT00000005233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQELRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAADQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQDNLQDEGTEYTGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLMTLTNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences M3Y1E5
ENSMPUP00000005146 ENSMPUP00000005146 XP_004770920.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]