SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005190 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005190
Domain Number 1 Region: 265-340
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000459
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005190   Gene: ENSMPUG00000005228   Transcript: ENSMPUT00000005278
Sequence length 403
Comment pep:known scaffold:MusPutFur1.0:GL896905.1:4050911:4074816:1 gene:ENSMPUG00000005228 transcript:ENSMPUT00000005278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLLTRPGQPTLTRVPPPILPRPS
QQTGSSNVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNGLGYNRLRVDDLPPSRFVQ
QAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFS
AFALVRTIRYLYRRLQWMIGLRRGSENEDLWAESEGTVACLGTEDRAANSAKSWPIFLFF
AVILGGPYLIWKLLSTHNDEITDNTNWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLN
LALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKAVESSKISKQQQPFNNTTL
TKGATAADSLDEQEAAFESVFVETNKVPVALDSTGKGGDKQDL
Download sequence
Identical sequences G9KG26
ENSMPUP00000005190 ENSMPUP00000005190 XP_004742077.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]