SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005195 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005195
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000612
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 
Domain Number 2 Region: 623-673,712-746,774-846,925-958
Classification Level Classification E-value
Superfamily RNI-like 0.0000746
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005195   Gene: ENSMPUG00000005233   Transcript: ENSMPUT00000005283
Sequence length 1007
Comment pep:novel scaffold:MusPutFur1.0:GL897159.1:1743739:1767950:-1 gene:ENSMPUG00000005233 transcript:ENSMPUT00000005283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFIKENSRVLIQRMGMTRIKQIVYELFVWNVLNHEEIKIICCKKVKQKAVRGIIPLILK
KGSESYNLFLRSLENFILFYFFSVFPTGLFQQISEEDLDDLTYNLKDLYHIPSFLSFCPL
SKDIDIIFNSKSTFTEGVLWKKDHHHYRVEQLTPNYLLDTLQSPCIIKGESGKWKSTLLQ
QIDTLWASGKCGALTKFKLIFFFQLSRAQGGLFATMWDQLVHIPDVIRKPTFLAMLLKLQ
QVLFLLGGYNEFRAQNCPETEILIKENHSLQNMGVVATTECLRHIRQFGALTAEWVMTED
SAQTLIWKVLTKEHAEGLLLQIQKSRCLRSLRKTPHFVVIICVIQMGENKFHSNTQTTLI
LTFYDLLIYKNQHKLREAAAGDFTQSLEYYGDLTLGGGFDFQPEDMSSVNEDTLPTTGLL
CKYTAQWFKPKYKFFPDSSQELAGCRVGNSLKSQEPEEVTKGNKMVFISDFTSKYSNLLP
YTWISYRSHRDCFERLQECIKMATSSGLVLSNTKKPLWRQESMQVKNTTMQETLKAININ
SFTECGINHIYESDLTKEFEASFCGKSLYIKSENIPDYLFDFFEHLLNWVSPLDFIKLNF
YGEALVSWDKITGDTSRRGEESSETYIPNMAMSLFCNWKQEFKTLEVTLWDFSKLNKQKI
RYLGKIFSSATSLRLCMKRYAGVARSFSSLLGTRENNFVTVEASALTIEEEQHITHVTNL
KTWSIQDLQTVWLSGIVHIISLRKNLDSVVQIMWWRGRGGDGEAKSKGEGDRGTNLKKMS
LLHPMHLSDIGKGMDYIVKFLSTETCDLEEIQLVSCCLSPNAVKTLVSNSLDFISLTDCL
EYICSVHGNEKNKCHRRQGTLGNLAATMYLQIYGNPSTVIPKKLKQRKHVFQKNIISQTD
LRIRRKEGGREERSLRCIFEKKHLKNFQQLNLARNYMSSDRSLAFKNVFQNLKQLVFFFF
LTIFALIRKLSHVLSKLTFVQKAKHVVWQFDGDNISVTKGVFKLVTA
Download sequence
Identical sequences M3Y1J4
ENSMPUP00000005195 ENSMPUP00000005195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]