SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005244 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005244
Domain Number 1 Region: 66-329
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.18e-39
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 918-974
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.44e-20
Family Tudor domain 0.00031
Further Details:      
 
Domain Number 3 Region: 975-1030
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000256
Family Tudor domain 0.00031
Further Details:      
 
Domain Number 4 Region: 750-788
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000775
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005244
Domain Number - Region: 843-885
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0122
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005244   Gene: ENSMPUG00000005282   Transcript: ENSMPUT00000005332
Sequence length 1095
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:1450560:1580157:1 gene:ENSMPUG00000005282 transcript:ENSMPUT00000005332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALSSPELSTWSA
SRASLKAKLLRRQISLKENRHWRKTEEDRKASLERKKEQPRRPGPPSHRKRSQPKKPKPE
DPKSPGEGATGATLLEEPGSLKEEASQEADPEEEEEEPQPTPPQGREAEATEEDGRGKLR
LAKARSDRKKKSYGPPHPHHPLLPQLPPPPPTQFPAEEAPRPLPPLEPPVLAPGPVPAEE
NPLPPPLNVVPPEAPGEEPEAFEHFAQRGPTWKEQAAPMELTGPEEESGAGEVQAPSTFS
KLKMEIKKSRRHPLGKPPTRSPLTVVKQEASSDEEAFPFSGEEDMSDPEALRPLLSLQWK
NKPASFQAERKFNAAAALTEPFCAICTLFYPYSQSLQTEKEAPQASLGEGPSAAPPSKSG
QKTRPLVPEMCFTASGENTEPLPANSYIGDDGTSLLIACAKCCLQVHASCYGIRPELVNE
GWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVMERHPVDIS
AIPEQRWKLKCVYCRKRMKKVSGACIQCSCEHCSTSFHVTCAHAAGVLMEPDDWPYVVSI
TCFKHKSGGHPAQFLRAVSLGQTVITKNRNGLYYRCRVIGASAQTFYEVNFDDGSYSDNL
YPESITSRDCVRLGPPPEGEFVELRWADGNMYKARFISSVTSHVYQVEFEDGSQLTVKRG
DIFTLDEELPKRVRSRLSLSTGAPQETAFSGEDVKAAKRPRVGTARAPEDSGRNPDYLAF
MESLLQAQCRPGAPF
Download sequence
Identical sequences M3Y1P3
ENSMPUP00000005244 ENSMPUP00000005244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]