SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005443 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005443
Domain Number 1 Region: 383-436
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000171
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 28-200
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000301
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005443   Gene: ENSMPUG00000005484   Transcript: ENSMPUT00000005534
Sequence length 439
Comment pep:known scaffold:MusPutFur1.0:GL897177.1:1371780:1375083:-1 gene:ENSMPUG00000005484 transcript:ENSMPUT00000005534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXXXXXXXAGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDV
GHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGASSRALGTLYSQV
SRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFLSLARGGCPAL
STELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPPAAEAPGSPPALQQTVHAVLHWGGRLA
QSLRGASGETPPGPRAPASAPTSGSWWEQLTQASRVYASGGSEGFPLPRWRSWRPGPAAG
GPQARPVPTEDAAPGRGLWLGRLFGVPGSLAETDGGPVKSRRPSSWLPPTVSVLALVKRG
APPEPLSPPEELEASAASLVQTHRAVRALCDHAAAGPDQLSFRRGEVLRVVATVDEDWLR
CGRDGAEGLVPVGYTSLVL
Download sequence
Identical sequences M3Y292
ENSMPUP00000005443 ENSMPUP00000005443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]