SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005632 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005632
Domain Number 1 Region: 534-664
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-16
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 86-253
Classification Level Classification E-value
Superfamily ARM repeat 0.00000168
Family HspBP1 domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005632   Gene: ENSMPUG00000005677   Transcript: ENSMPUT00000005729
Sequence length 722
Comment pep:novel scaffold:MusPutFur1.0:GL896910.1:18184749:18189002:1 gene:ENSMPUG00000005677 transcript:ENSMPUT00000005729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRNVVKIAVQMPDAIPQLIRLDQAKPLAAVLKEVCDAWSLDHSECYALQFADGHRRY
ITENNRAEIKNGSILCLSTAPDLEAERLLHGLQNGSRERRRETLHHLVLLAPDVTFAQEV
ISRDGLQRLGTIIEDGDDLGEVLTLALRAFLELMEHGMVSWETLSIPFVRKVVCYVNMNL
MDASVQPLALRLLESVTLSSPALGQLVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQ
GASPTERKHMLDYLWQRNLRQFIYKNIIHSATPLGDEMAHHLYVLQALTLGLLEPRMRTP
LDPYSQEQREQLQALRQAAFQSEGESLGSGLSADRRRSLCAREFRKLGFSNSNPAQDLER
VPPGLLALDNMLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLTVLLCELLRVGEP
CSETAQDFSPMFFSQDQSFHELFCVSIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLA
LKPSSLELFRTKVNALPYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRL
LRLCEGTLFRKISSRRRQLTDKLWFCCLSPNHKVLQYGDMEEGASPPTLDSLPEQLPVAD
IKALLTGKDCPHVREKGSGKQNKDLYELAFSISYDHGEAEAYLNFIAPSKREFHLWTDGL
SALLGSPMGSEQTRLDLEQLLTMETKLRLLELENVPIPEQPPPIPPPPTNFNFCYDCSIT
EP
Download sequence
Identical sequences M3Y2T1
ENSMPUP00000005632 ENSMPUP00000005632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]