SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006249 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006249
Domain Number 1 Region: 154-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 41-150
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-30
Family Pleckstrin-homology domain (PH domain) 0.00000607
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006249
Domain Number - Region: 547-640
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006249   Gene: ENSMPUG00000006303   Transcript: ENSMPUT00000006358
Sequence length 646
Comment pep:novel scaffold:MusPutFur1.0:GL896905.1:10949590:11038023:1 gene:ENSMPUG00000006303 transcript:ENSMPUT00000006358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKVEAGKIARSRSVMTGEQMAALHQLSAPNPLERPIKMGWLKKQRSIV
KNWQQRYFVLRAQQLFFYKDEEDTKPQGCMYLPGSTVKEIATNPEEVGKFVFEVIPASWD
QSRTGQDSYVLMASSQAEMEEWVKFLKRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPIL
VEKCAEFILQHGLNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRETDVHTVASLLKLYL
RDLPEPVVPWNQYEGFLLCGQLMNADEAKAQQELVKQLSILPRDNYSLLSYICRFLHEIQ
LNCGVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDA
PLSPPAQKNDPKKPPVARSSVGWDATEDPPISRTESFSNVTSDSDTTSPTGQRPNDGFLE
ESSKAPREKLGDWKLQSRKRTQTLPNRKCFLTSAFQGANSSKVEIFKNEFWSPSSEVKAG
EGHRRTMSQGVPPCPDSQRTSTYDNVPAPPCTPGDEAAASSYQACDSKRETLASSTSETG
PGKKNSGEEELESLQRVVQELQKEIETQKQTYEEQIKNLEKENYDVWAKVVRLNEELEKE
KKKSAALEISLRNVERSREDVERRNKALEEEVKEFVKSMKEPKADA
Download sequence
Identical sequences M3Y4J8
ENSMPUP00000006249 XP_004742156.1.14098 ENSMPUP00000006249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]