SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006282 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000006282
Domain Number - Region: 16-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000817
Family GntR-like transcriptional regulators 0.062
Further Details:      
 
Domain Number - Region: 64-158
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006282   Gene: ENSMPUG00000006336   Transcript: ENSMPUT00000006391
Sequence length 200
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:20601701:20602317:1 gene:ENSMPUG00000006336 transcript:ENSMPUT00000006391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKKGLSAEEKRRMMEIFFETKDVFQLKDMEKIAPKEKGITAMSVKEVLQSLVDDGMVD
CERIGTSNYYWAFPSKALLARKCKLEVLESQVSEGNQKHTNLQKSIEKAKIGLHETEESK
ELSSLRDQREQLKAEVEEYKECDPQVVEDIRQANKIAKEAANRWTDNIFSIKSWAKRKFG
FKENKIDKNFGIPEDFDYID
Download sequence
Identical sequences M3Y4N1
ENSMPUP00000006282 ENSMPUP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]