SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006312 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006312
Domain Number 1 Region: 935-1028
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.35e-18
Family Tudor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 491-582
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-18
Family Tudor domain 0.0025
Further Details:      
 
Domain Number 3 Region: 676-776
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.13e-16
Family Tudor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006312   Gene: ENSMPUG00000006366   Transcript: ENSMPUT00000006421
Sequence length 1098
Comment pep:novel scaffold:MusPutFur1.0:GL896918.1:3992436:4067511:1 gene:ENSMPUG00000006366 transcript:ENSMPUT00000006421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEADLVSKMLRAVLQSHKNGIALPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVV
RIETSRSGEITCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPK
ATLRQPGISSDFSISKKPNPTLLRDKGNSLGIKSDAEMPPYTLHTTIGSDVFKDVPGQRH
VTIPTNNRFSPKASLPPPFQMHLSRTCAKEVSDNLNQTVEKPNVTPPASYTYKMDEVQNR
IKEILNKHNNGIWISKLPHFYKELYKEELNQGILQQFEHWPHICTVEKPCSGGQDLLLYP
AKRKQLLRGELDGEKVPPSPLPAPKPIPPLKECPTVIPGDLKEKVAELLAKYSSGLWASA
LPKAFEDMYKVKFPEDALKNLASFSDVCTIDYISGNPQKAILYAKLPLPTDKILKDAGQA
HGDYDIKSMIEQEYLQIEENIAKCADTFVENIAVPPLIIPTEASPSVLVVELSNTNEVVI
RYVGKDYSAAQELMEDEMKEYYSKNPKVTPVQTVHVGQLLAVNAEEDAWLRAQIISMDEN
KIKVCYVDYGFSENIEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTC
GKIFAVEILEKADIPLVVLYDTSGEDDVNINATCLKAICDKSLEAHLQIDAMYTNVRVTN
ICSDGTLYCQVPCKGLNKLNDLLHKIEDYFHCKHMTSEYFVSLPFCGKVCLFHCKGKWLR
VEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEIIVIPPQAIKCCLADLPQSI
GMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHIYLFTPKNFPDPHRSINRQITNAD
LWKHQKDVFLSAVSSGTSSPNSKSGGTPVLGNTGENFRKNLTDAIKKSVVDHSSSFSTEE
LPPPVHLSKPGEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVE
KDQVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAV
TAQLAGVKCNQWSEEASMVFRNHVEKKPLVALVQTVIENANPWDRKVVVYLVDTSLPDTD
IWIHDFMSEYLVELSKVN
Download sequence
Identical sequences M3Y4R1
ENSMPUP00000006312 ENSMPUP00000006312 XP_004747715.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]