SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006453 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006453
Domain Number 1 Region: 209-310
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-32
Family DEATH domain, DD 0.0000292
Further Details:      
 
Domain Number 2 Region: 103-147
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000017
Family TNF receptor-like 0.0012
Further Details:      
 
Domain Number 3 Region: 45-98
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000074
Family TNF receptor-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006453   Gene: ENSMPUG00000006508   Transcript: ENSMPUT00000006564
Sequence length 311
Comment pep:novel scaffold:MusPutFur1.0:GL897268.1:370748:396050:-1 gene:ENSMPUG00000006508 transcript:ENSMPUT00000006564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGCPKVFTSIAGPWPKAVSAQATAVNSKALRFRKSITIRETGCWEDQHGEKRVCCQPC
PAGTRKEGDCRSAGGESKCVPCQDGEEYMEEKHFLDKCRRCRICDGEHGLEVERNCTRSQ
NTKCRCKPNFFCNISGCEHCTPCTTCEHGVLENCTPTSNTKCKEGASSSFLWFCVLIPIL
IVALICWWWLRRHRNKKTEDPESKPSTTEMMPINCADVDLNTYISIIAEQMRITEVREFV
RKNGINEAKIDEIKNDHLQDTAEQKVQLLRHWYQLHGRKDAYYSLLRGLRKAHLCELAER
IQEMIQEDSTS
Download sequence
Identical sequences M3Y552
ENSMPUP00000006453 XP_004780821.2.14098 ENSMPUP00000006453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]