SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006455 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006455
Domain Number 1 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006455
Domain Number - Region: 140-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000126
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006455   Gene: ENSMPUG00000006510   Transcript: ENSMPUT00000006566
Sequence length 542
Comment pep:novel scaffold:MusPutFur1.0:GL897027.1:5349813:5368425:-1 gene:ENSMPUG00000006510 transcript:ENSMPUT00000006566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFKEMVTFKDVAVVFTEEELGLLDPSQRKLYRDVMLENFGNLVSVGHQPFKRGGVHLV
REEKFGMMKLATQRKGISGDKVQHEMETIAKAEPHEELSSWQIWQQIAKDLARYQDSMIK
SSQFYKQHDLPGQVGAGLPITHSGQKTYQGNGCKKFFSDISNCDLQQLNSRAKSHTCREC
GKCFFYSSALRIHQRVHLGERQYRCDECGKEFSQSSHLQTHQKVHTIGKPFKCEECGKGF
SRKSELSNHCRLHSGEKLYKCKGCGKAFINACHLQDHQRIHTGEKPFKCDICGKSFRRRS
ALNSHCVVHTGEKPYRCEDCGKSYTWRSRLRIHKKVHMGQKPHKCEECGKSFFSRTHLYY
HRRFHTEEKPYHCKECGKSFRWVSPLLTHQRVHSGEKPFKCEECGKGFGQKSCLQAHQKV
HTREKPYKCEECGKGYKTSLDLDVHQSVHMGENPYTCRACGKHFTRTSNLKVHQRVHTGE
KPYKCNVCGKVFSQSGHLKSHQRVHTGEKPYKCKICGKQFSSSSYVKIHHRIHAGDKFHP
VS
Download sequence
Identical sequences M3Y554
XP_004767726.1.14098 ENSMPUP00000006455 ENSMPUP00000006455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]