SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006634 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006634
Domain Number 1 Region: 281-488
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-54
Family Nuclear receptor ligand-binding domain 0.00000000447
Further Details:      
 
Domain Number 2 Region: 166-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006634   Gene: ENSMPUG00000006688   Transcript: ENSMPUT00000006747
Sequence length 521
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:17259669:17316586:-1 gene:ENSMPUG00000006688 transcript:ENSMPUT00000006747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCASPHKEFPQLLPIQDMDIKNSPSSLNSPASYNCSQSVLPLEHGPIYIPSSYVESRH
EYSTMTFYSPAVMNYSLPSSASNSEGGPGRQTTSPNVLWPTPGHLSPLAIHCQSSLLYAE
PQKSPWCEARSLEPTLPVNRETLKRKVSGSSGASPITSPSSKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
ERCGYRVMRRQKSSEEQLHCLSKAKKNGGHVTRVKELLLSALSPEQLVLTLLEAEPPHVL
VSRPSTPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVK
AMVLLNSSMYPLAAASQEAESSRKLTHLLNAVTDALVWVIAKSGIPSQQQPVRLANLLML
LSHVRHARYAAPFKNLVKTMNTLPGKRYINTNMLDYIIQED
Download sequence
Identical sequences M3Y5N3
ENSMPUP00000006634 ENSMPUP00000006634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]