SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006988 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006988
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-28
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 489-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 386-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000164
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 429-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000308
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 197-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000905
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006988   Gene: ENSMPUG00000007045   Transcript: ENSMPUT00000007104
Sequence length 634
Comment pep:novel scaffold:MusPutFur1.0:GL896910.1:19304074:19327282:1 gene:ENSMPUG00000007045 transcript:ENSMPUT00000007104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPPTAAPQESVTFKDVAVDFTQEEWHHVDPAQRRLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWISEGEIQRPFCPDWKTRPEAKSSHLQEGISTGSRSTDGLSHATFQST
WDVGSQFERHQENWKRYLGPDASNQKKIITPEENFQQNKFGENSRLNTVLVTQLNIPSRP
NECGTFGSNLGHTSDIINQNNILAKKKPYKCDKCRKAFIHRSSLTKHEKTHKGEGAFPNG
TDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQHEN
AHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSG
EKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGKPY
QSNNYSIDFKHNSSLTQDESTVAEVKSYHCNDCGEDFSLITDFTDHQRIHSGQNPYECEQ
NFSQQPVSHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQ
HERTHTGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECHECGRAFRKKTNLHDHQRI
HTGEKPYACKECGKNFSRSSALTKHQRIHARNKL
Download sequence
Identical sequences M3Y6N7
XP_004744576.1.14098 XP_004744577.1.14098 ENSMPUP00000006988 ENSMPUP00000006988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]