SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007327 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007327
Domain Number 1 Region: 710-984
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.11e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000716
Further Details:      
 
Domain Number 2 Region: 296-442
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-35
Family Third domain of FERM 0.00018
Further Details:      
 
Domain Number 3 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-32
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 4 Region: 587-678
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 108-193
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.6e-20
Family First domain of FERM 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007327   Gene: ENSMPUG00000007385   Transcript: ENSMPUT00000007447
Sequence length 994
Comment pep:novel scaffold:MusPutFur1.0:GL896918.1:14004332:14101080:-1 gene:ENSMPUG00000007385 transcript:ENSMPUT00000007447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPREGQLLGIWSSALRAGLRGSRGFCRGEWEFQPSNHCVDLRSESKTPFLLPSGEDRCP
DPGRETIKNVSFRSLGCSAIVMTSRLRALGGRINNIRTSELPKEKTRSEVVCSIRFLDGS
VQTFKANKQDTGQVLLDMAYNHLGVTEREYFGLQHGDDSIDSLRWLESSKPIRKQLKGGF
PCTLHFRVRFFIPDPNTLQEEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFG
DYNSSIHHPGYLSDSQFIPDQNDDFLTKVESLHEQHSGLKQSEAESCFINIARTLDFYGV
ELHSGRDLHNLELMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTES
REHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLAQYWTMGSRNPKKSVNNQ
YCKKVIGGMVWNPALRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNL
VNEMTYITETEDVFYTYKGSLSPKDSESEVSQNRSPHRESISENNPAQSCLTQKSSSSVS
SSSNAPGSCSPDGVDQQFLEDFHRVTKGGSAEDCSQYYCDKNDHGDGYLVLIRITPDEDG
KFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFI
KASRESHTRELALVIRRKAVHSFADIKSEDELNQLFPEAIFPICPEGGDTLEGSMEQLKK
GLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINAS
YVNMEIPAANLVNKYIAAQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWP
DPPDVMEHGNFHIRCQSEDCTIAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSS
DFLEFVNSVRSLRVDGEPVLVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRD
QRAMMVQTSSQYKFVCEAILRVYEEGLVQMLDPS
Download sequence
Identical sequences M3Y7M0
ENSMPUP00000007327 ENSMPUP00000007327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]