SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007436 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007436
Domain Number 1 Region: 10-103
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-28
Family PDZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007436   Gene: ENSMPUG00000007492   Transcript: ENSMPUT00000007556
Sequence length 145
Comment pep:known scaffold:MusPutFur1.0:GL896900.1:22582568:22619190:-1 gene:ENSMPUG00000007492 transcript:ENSMPUT00000007556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGSVDYSVTEEEISLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQ
EGDKILSVNGQDLRNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPVGHRSEGEPSGIPI
ALVLVPVFALTMVAVWAFMRYRKQL
Download sequence
Identical sequences M3Y7X9
XP_004739087.1.14098 ENSMPUP00000007436 ENSMPUP00000007436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]