SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007553 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007553
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 251-368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000275
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007553
Domain Number - Region: 365-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00209
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007553   Gene: ENSMPUG00000007608   Transcript: ENSMPUT00000007674
Sequence length 769
Comment pep:known scaffold:MusPutFur1.0:GL897008.1:3333161:3342662:-1 gene:ENSMPUG00000007608 transcript:ENSMPUT00000007674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPRAAVGPRQVSGPQAPLPPTTTVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGGGGEGTAGDAGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPASGTTPDPPAPLTDIGSP
VAAGDGPPGAPGHGPEVGSAVPPSLGLRDPECRLVDKDRKASRDTLVDSPAPGDMLRDPC
SAQDPHSPAPTASSALGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences M3Y896
ENSMPUP00000007553 ENSMPUP00000007553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]