SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007616 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007616
Domain Number 1 Region: 18-97
Classification Level Classification E-value
Superfamily HR1 repeat 9.94e-19
Family HR1 repeat 0.004
Further Details:      
 
Domain Number 2 Region: 501-591
Classification Level Classification E-value
Superfamily PDZ domain-like 1.48e-17
Family PDZ domain 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007616   Gene: ENSMPUG00000007671   Transcript: ENSMPUT00000007737
Sequence length 686
Comment pep:novel scaffold:MusPutFur1.0:GL897008.1:3471618:3528084:1 gene:ENSMPUG00000007671 transcript:ENSMPUT00000007737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDALLPAAPQALEKESDSYFRKGCNPLAQTGRSRLQNQRAALNQQILKAVRMRTGAENL
LKVATNQKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQNTEEAFTVPLIPLGLKET
KDVDFSVILKDFILEHYSEDSYLYEDEIADLMDLRQACRTPSRDEAGVELLMSYFIQLGF
VESRFFPPTRQMGILFTWYDSFTGVPVSQQNLLLEKASILFNIGALYTQIGTRCNRRTQA
GLEGAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQENVFEKICLPGI
RNEFFVLVKVAQEAAKVGEVYQQLHTAMSQAPVKENIPYSWASLACVKAHHYGALAHYFA
ATLLIDHQLKQGADEDHQEKCLSQLYDHMPEGLTPLATLKNIHQRRQLGKSHVRRAVALH
EESVREASLCKKLRNIEVLQEVLSAAHRRSQLKDAQLQEDDDLLDLIEAPDIVSKTEQEV
EIILPQFSKVTVTDFFQKLGPLSVFSANKRWTPPRSIHFTAEEGDLGFTLRGNSPVQVHF
LDPHCSAALAGAKEGDYIVSIQDVDCKWLTVSEVMRLLKACGQDGVDMKVVSLLDFTSSM
HSKCATYSVGMQKTYSMICLAIDDDDKTDKTKKISKKLSFLSWGTNKNRQKSASTLCLPS
VGVARPQVKKKLPSPFSLLNSDSSLY
Download sequence
Identical sequences M3Y8F9
ENSMPUP00000007616 XP_004765269.1.14098 ENSMPUP00000007616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]