SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007699 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007699
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000276
Family SH3-domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007699
Domain Number - Region: 598-664,794-942,976-1141
Classification Level Classification E-value
Superfamily ARM repeat 0.000288
Family MIF4G domain-like 0.074
Further Details:      
 
Domain Number - Region: 449-532
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0142
Family PLC-like (P variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007699   Gene: ENSMPUG00000007755   Transcript: ENSMPUT00000007822
Sequence length 1968
Comment pep:novel scaffold:MusPutFur1.0:GL896904.1:24970803:25402598:1 gene:ENSMPUG00000007755 transcript:ENSMPUT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNVKGIFPSS
YVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMN
EILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDTPVQASNHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLGSSELRRDVYITVHIIRIGRMGAGEKKNACSTQYRRP
FGCAVLSIADLLTGDTKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV
ARNVEVTMFIVESSGQILKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKF
RGAHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTT
RYLKLPFSKGILLGNNHQAIKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGC
LSKIKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTIVHVDDSLQAVKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHM
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPS
GSAMRLQFQDVTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIR
PEMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCL
QLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPALIGPFLEVTLIPQAD
LRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGP
YPSLLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKT
ELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQR
KEHLHLAIIQNFDRGKCWENGIVLCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQR
LEPEFFRVGFYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDET
IFQAEAQYLQIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKEN
EFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQ
TRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKIARLRELMLEQA
QILEFGLAVHEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACIQASPVHFPNGSPRVC
RNSAPASMSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQ
PSPSTSSLSSTHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPV
EPSQRLLFNHIGEGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKIISPPVP
PRPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGI
SSLSRCSTSETSGFENQVNEQSAPGPSYSGSEEPGRKESKTPPPYSVYERTLRRPVPLPH
SLSIPVTAEPPALPPKPLAARPGHLENGTRRTEPGPRPRPLPRKVSQL
Download sequence
Identical sequences M3Y8P2
ENSMPUP00000007699 XP_004742000.1.14098 ENSMPUP00000007699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]