SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007738 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007738
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-21
Family THAP domain 0.00043
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007738
Domain Number - Region: 335-391
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007738   Gene: ENSMPUG00000007795   Transcript: ENSMPUT00000007862
Sequence length 394
Comment pep:known scaffold:MusPutFur1.0:GL896904.1:28119447:28129174:1 gene:ENSMPUG00000007795 transcript:ENSMPUT00000007862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRYCAAVCCKNRRGRNSKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDH
FTPDSLDVRWGIRYLKQTAIPTIFSLPEDNQEKDSSKKKSQKKKLDDEKEVCLKAKSQES
FASNELKKNTVNTDILPEHTELLNSSTLVKLPAPKPEGIQNNILTLNLVKQDIKKPVSTL
ETSVTQDIDIGGFHTSFENLNSTTITLTTSNSEDIQPSLETQEVFEITTNHLANPNFTNN
SMEIKSAQESPFLFSTITKTVEELNANKESVIAIFVPTENSKPINSFVSTEKETVEMGDL
DPEGSLYKDIDYETEVLQIEHSYCRQDINKEHLWRKVSKLHSKITLLELQEQQTLGRLKS
LEALIRQLKQEHWLSEENVKIIENHFTTYEVTML
Download sequence
Identical sequences M3Y8T1
ENSMPUP00000007738 XP_004742006.1.14098 ENSMPUP00000007738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]