SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007828 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007828
Domain Number 1 Region: 243-301
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-18
Family Erythroid transcription factor GATA-1 0.00056
Further Details:      
 
Domain Number 2 Region: 192-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000124
Family Erythroid transcription factor GATA-1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007828   Gene: ENSMPUG00000007886   Transcript: ENSMPUT00000007953
Sequence length 404
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:7625088:7635748:-1 gene:ENSMPUG00000007886 transcript:ENSMPUT00000007953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLALAPSPGQAAYADSGAFLHAPGAGSPVFVPPARVPSMLPYLPACEPGPQAPGLAG
HPGWAQAAAADSSAFGSRSPHPPAAQPPGATAFPFPHSPPGPSGGGGATTRDGGAYQGAL
LAREQYPAPLRRPVSASYPTAYPAYVSTEVAPSWTPGPFEGSVLHGLQSPPAGLPSRRAS
FVSDFLEELPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRL
SSSRRAGLSCTNCRTTTTTLWRRNADGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRK
PKGVVKTKSSSGCPANSTASPPSVPDPENPAAALKPKPSLASPSCPGSSVASQASSQADD
PLAPSHLEFKFEPEDFAFPSTALGPQAGLGGALRQEAWCALALA
Download sequence
Identical sequences M3Y921
ENSMPUP00000007828 ENSMPUP00000007828 XP_004760050.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]