SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007940 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007940
Domain Number 1 Region: 21-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.51e-16
Family LIM domain 0.00078
Further Details:      
 
Domain Number 2 Region: 142-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.73e-16
Family LIM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 102-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000357
Family LIM domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007940
Domain Number - Region: 3-20
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0238
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007940   Gene: ENSMPUG00000007998   Transcript: ENSMPUT00000008065
Sequence length 196
Comment pep:novel scaffold:MusPutFur1.0:GL897365.1:83933:85406:-1 gene:ENSMPUG00000007998 transcript:ENSMPUT00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVSPAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG
GAGSYIYEKPAAEGPQVTGPVQVPAARAEERKAGGPPKGPSRASSVTTFTGEPNVCPGCN
KRVYFAEKVTSLGKDWHRPCLRCGRCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNT
GAVGSYIYDRDPEGKV
Download sequence
Identical sequences M3Y9D3
ENSMPUP00000007940 ENSMPUP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]