SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008019 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008019
Domain Number 1 Region: 30-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000203
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008019
Domain Number - Region: 77-166
Classification Level Classification E-value
Superfamily TRAF domain-like 0.034
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008019   Gene: ENSMPUG00000008078   Transcript: ENSMPUT00000008145
Sequence length 215
Comment pep:novel scaffold:MusPutFur1.0:GL896939.1:1037955:1040333:1 gene:ENSMPUG00000008078 transcript:ENSMPUT00000008145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLSRNSRGELPCEVAGSQQPSGPCRVPGRFCGECLQPCLQVPSPLCPLCRLPFDPKKVD
KAVHVEKQLSSYKAPCRGCSKKVTLAKMRVHVSSCMKVQEQMANCPKFVPVVPTSQPIPS
AVPNRSTFTCPYCGARNLDQQELLKHCVDNHRSDPNRVVCPICSAMPWGDPSYKSANFLQ
HLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN
Download sequence
Identical sequences M3Y9L2
ENSMPUP00000008019 ENSMPUP00000008019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]