SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008075 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008075
Domain Number 1 Region: 222-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-56
Family Prokaryotic proteases 0.0000000161
Further Details:      
 
Domain Number 2 Region: 434-530
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family HtrA-like serine proteases 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008075   Gene: ENSMPUG00000008134   Transcript: ENSMPUT00000008203
Sequence length 533
Comment pep:known scaffold:MusPutFur1.0:GL896905.1:15686924:15690088:1 gene:ENSMPUG00000008134 transcript:ENSMPUT00000008203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGPLGHLITRVPRGPQFPAFARRGGVGLLESWVRRALLEDFRYRRAPRPSVRQLASRA
PPLCRAGEKAAEAELMAALRAGRGAGWSLRGWRALGGVRWGKGPLLTPDLRALLTSGTPD
PRARVTYGTPSLRARLSVGVPEPRTCLTSGTSDSRARLTAGTPDSRTREVSGTPGTRSRV
WLAVALGAGGAVLLLLWGGGRGPPAVLASVLGPPPTSPRSQYNFIADVVEKTAPAVVYIE
ILGRHPFSGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAMVTAVDP
VADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDL
GLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRG
EKKNSWFGISGSQRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRA
GLRPGDVILAIGEQLVQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
Download sequence
Identical sequences M3Y9R8
ENSMPUP00000008075 ENSMPUP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]