SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008077 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008077
Domain Number 1 Region: 419-453
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000446
Family LIM domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008077   Gene: ENSMPUG00000008136   Transcript: ENSMPUT00000008205
Sequence length 597
Comment pep:novel scaffold:MusPutFur1.0:GL897246.1:581194:594184:1 gene:ENSMPUG00000008136 transcript:ENSMPUT00000008205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVP
HELPTKQDGGGIKGYEEKLNGSLRPHGDGRAAGRPGKENISDEPVDMSARRRTPNNGKLP
ESEPLKILFLSNLKAVSPCGHSSVLPEVWLIAVYLWSGKGMEERQQLIKQLRDELRLEEA
RLVLLKKLRQSQLQKENVVQKTPVVQNAASIVQPAPAHGGQQGLSKLPSRPGAQGVEPQS
LRTLQGHSVIRSAANTALPHMLMSQRVIAPNPAQLQGQRGPPKPGLVRTTTPSMNPAINY
QPQSSSSVPCQRTASSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQAAAKLALRK
QLEKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPF
VCAQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQR
LQQQAALSPTAAPAVSSVSKQDTIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQ
LSVPGGLLGMPGPGVNIAYLNTGIGGHKAPSLADRQREYLLDMIPPRSIAQSISGQK
Download sequence
Identical sequences M3Y9S0
ENSMPUP00000008077 ENSMPUP00000008077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]