SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008229 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008229
Domain Number 1 Region: 43-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-37
Family SCAN domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000163
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 234-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000811
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 4 Region: 345-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000464
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008229   Gene: ENSMPUG00000008291   Transcript: ENSMPUT00000008360
Sequence length 466
Comment pep:novel scaffold:MusPutFur1.0:GL897253.1:284152:296015:-1 gene:ENSMPUG00000008291 transcript:ENSMPUT00000008360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGSPALVPLVGYKKTPSTTMPSPLGPPRLPSVDAVAILEEPEAARLRFRGFCYQEVAG
PREALARLRELCRQWLRPEACSKEQMLELLVLEQFLSTLPPEIQAWVRGQRPGSPEEAVA
LVEGLQHNPGQLLGWITARVLKQVVFPAAQKTEESLGRSHPSGTVELLGATSREGSQDTQ
MERSAQLSCRVKEEPDADGQEMASSSPPVPAQCHEGHPGHREPASTSFHAPRIQEEWGLL
DPSQKELYWDAMLEKYGTVVSLAGIPAPQPEAQVELEPGALRTGTEGRRSLHPGDESESH
CEGPPQCPEAQPPQGPGSVTWEGPSGASVSARAMLGTGLEAGALRRKPYTCELCGRGFDW
KSVFVIHHRTHAEGQGPQALGIGGAQKLPLGSRELDTPRPPRRMLPGPRSYVCEDCGRSF
SWKSQLVIHRKGHVGQRRHLCGDCGRGFDWKSQLVIHRKSHRPEAP
Download sequence
Identical sequences M3YA72
ENSMPUP00000008229 ENSMPUP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]