SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008298 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008298
Domain Number 1 Region: 1538-1843,1907-2007
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-83
Family RNB domain-like 0.0000855
Further Details:      
 
Domain Number 2 Region: 2436-2524,2560-2752,2784-2921
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.25e-57
Family Extended AAA-ATPase domain 0.073
Further Details:      
 
Domain Number 3 Region: 763-838,877-1191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-43
Family Extended AAA-ATPase domain 0.053
Further Details:      
 
Domain Number 4 Region: 1404-1504,1537-1564
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000857
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008298
Domain Number - Region: 286-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0107
Family Classic zinc finger, C2H2 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008298   Gene: ENSMPUG00000008361   Transcript: ENSMPUT00000008431
Sequence length 2937
Comment pep:known scaffold:MusPutFur1.0:GL896972.1:8381843:8395969:-1 gene:ENSMPUG00000008361 transcript:ENSMPUT00000008431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPRSGSSPTSPMATKEQSLARLCAQVDLHLGCPHCTQRLNESTYVLRRTEHHCPREIL
LARFRGATKSRVWRKVARRPSFPRPARYDVCWYYSPGLGCRRHGNQCTFARSREEALVWN
FEREHNVGRLWLKTELQGGGAQGEQHSPADAIRAEHGGHFQLLCSHCFRSCPPRLCPMDA
QGHCPQHGACPSLLAHVSAEGRRKQQVVEVRPQPQYGQPLAYCMYVGRGRPCRHGASRCQ
YAHSAVEMAVWEAEQLGGLQRRDLLSPTAPREDECAAPCGQPPSVRLYCRACLVTCPSQE
AFENHCSSLDHAQMVALDPAEIWEHRSPPTGLSAFELCPNPDLCEYGDACTKAHSEPELQ
EWVRRAQGLELREQAAWQEGLVSYQARLLAEYQRSRSEVLVLAETVDGVSVTCNQPLVHQ
APEKKTRHSWVFDIRSEEPLLHVALLKQELGADFSLVAPRLPPGQLYAKGERFRVRAAPA
GFRVEVRVQGASFGCFEQWVVFDFGRRPALLRKLGLLLGQVHCPGPQGRPACGHAEELER
WHTGNRHVVPGVERTAEQVALVAKYKVPALALDFSPGGSVPGPMSCADYRPRVHQFLYEE
EAAQQRLVARLNFRGPVSLRTALETPALGMLFPPSGALYAEVPTPSARTPDSDEGFLLGR
AVSTALVAPVPAPDRTVFEVQLETRASSERAVWLLLPARCCVALGLRPDTSPFLEVQFQI
DPLTFRFWHQAVDALPDVRLVVPDLPTCSLPRPLPAPPAMRGNHKQKLAVALIAGSSPGG
VRPIAPLLIYGPFGTGKTYTLAMASLEVIRQPHTRVLICTHTNSAADIYIEEHFHRYVSS
GHPEATPLRVMFTDRPPSQTDAATLRYCLLTGDRRAFRAPTRAELEQHRIVVATASQARE
LRVPSGFFSHILIDEAAQMLECEALTPLRYAGPGTRLVLAGDHRQVTPRLFSVPSAQAAG
HTLLCRLFWHYQREAHAVARHSRLIFHENYRCTEAILQFVSRHFYLAEGSPIHASGRVPR
HPTHYPLMFCHVAGNPERDLSRASWLNAAEIAQVVEKVQEIYQTWPPCWGSREQRHICAV
SHGAQVVALRQELRKRDLGQVSVGSFEILPGREFRAVVLSTVHSCSSLLSCGAPALGFFT
DARVLNTVMTRAQSQVVAVGNAVALCSFGACSKLWKSFIRECMKHCSVWPESLSLEHIEQ
SAVQSRRQRWALHAERSVAAVAQDAVPQEGTTGALATEHVATDEVAPGAEGKTSPPETWA
AGGEAAQSTEAGDAAPASAAGGCRAVRETATVPPEAEDRTSAGNSSVGDVALGKAVAGLP
ATEDGDPEDLEDSESDFWPSDLELNADDSILQELLDEARNLAVTVREDGLLDAVAQPESP
QQARQYRSLPRAALRKLLSLEPELYRPCAFMQETFERALAIPLDDADCGPIHIRGRLHCG
MAFSGDEVLVEVLGADRGPSGRLQGRVVGVLKRKRRELVFVCRTDEWDPRIMTPIDGSVT
KIFVAELKDPLQVPVHCVQQGRVRRVGYERLPAEARGSRLFLVRVVLWRPRFYYPLGIIL
EVLPEATTWEQSLRILDLEHGLRAPGPEPASVSKALQKYRAELSRAPDRREDCRGFLTFT
VDPQGACYLDDALSVRDLGSRYEVAVHIADVASAVPRDGPLDLEARRRGVTFYAPDREPQ
PMLPASLCQDALSLLPGQDRLAVSLFLTVEKGSDQLKGLHIAPSVIRSDRQLSYEEAEHI
IRQHPGAGGELPSLLDSVDACVVAACHFSRVLRRVRLETDAHYEQPSEDCVLGFRAAHTM
VKEYMIQFNRLVAELLVSSECTRTVTLLRWQPAPSERQLAALEEKHGELVPLSLHLHHHL
RGCGSPGRQVYLLATLWRHLQRAARAGDHNLLADLITTDDVHPSLAPVGLDLRKALGRSV
FGRSRQGEQQAAGHYALRVDWYTWATSPIRRYLDVVVQRQVLLVLGHGGAPYSARDIDGL
CQEFSHQHARAQAYQRQARSLHLAAQLRVQPRGKLGIVAGVEMGARGFKLLFPTNPETLP
DPCPVQYRALQLAEHPRDLAGRPGLRLEWRRRIYSVQAEGLRSPQPGTLLDPHTRRVDAA
RWEQLLELVQAERWPEAAALVRELGTAEPPPRELGRVRHSRCGHFVEVSRELGSGDVLQV
QLSACPQRGFLVPSLQLCTVAPGLTLCLQHVERPGDCFLDQAPRAAQDRCLDEGEYARVW
GPFCSLESAAGAVSEGDSITLQQVSVSWDTKQVAQGRLCGSFCMEPSFLSEHGIDLGFGH
CYLCIRLEGLPAMPVTGELHPPAGPGRPPLLSIDPDTYTWVAHGLTGHWDPKEGQADRQE
TSRQVYFFVQHMPMEKVPEEVLRSGTRFTIEVLPKQLPDIRKEEAVSRLDRASPLVVSIA
LGRPIPPPFRLAPEQTLHRGTYSRLLEKRMFDLPGGRHTLNSSQNRAVRAALQKPFTVIQ
GPPGTGKTVVGFHIVFWFHKANEEQVMAWGAPREEELLGGPCVLYCGPSNKSVDVLAGLL
LSRRAELKPLRVYSEQAEATEFPGPSVGSSGPPRKTPREGRPNQSLRSITLHHRVRQASN
PYAAVIRGFDARVQKGEVFSKDDLNWYKQVLGKARRFELERHRVILCTCSCAASAGLRRL
AVRQVLVDEAGMATEPETLIPLVAFSGVEKVVLLGDHKQLRPVVRSEQLQNLGLDRSLFE
RYHADAFLLDTQYRMHADICAFPSTEFYKKKLKTWPGLKRPPSVLGHAGKESCSVIFGHV
QGHEQSLLVSTDEGNENSKANPEEVAEVVRIAKQLTLGRTVDPKDVAILTPYNAQAAEIG
KRLGQEGVTGVSVCSITKSQGSEWRYVLVSTVRTCPESDLDQRPTKSWLKRFLGFVVDPN
QVNVAITRAKEGLCFIGDHRLLRCCPLWRRFLDFCEDQQSLVPASQVRVRRRPALSP
Download sequence
Identical sequences M3YAE1
ENSMPUP00000008298 ENSMPUP00000008298 XP_004760090.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]