SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008414 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008414
Domain Number 1 Region: 653-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-59
Family Protein kinases, catalytic subunit 0.0000000621
Further Details:      
 
Domain Number 2 Region: 33-218
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.74e-55
Family Ephrin receptor ligand binding domain 0.00000545
Further Details:      
 
Domain Number 3 Region: 358-571
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-33
Family Fibronectin type III 0.0000595
Further Details:      
 
Domain Number 4 Region: 936-1007
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.5e-17
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008414
Domain Number - Region: 288-361,397-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008414   Gene: ENSMPUG00000008478   Transcript: ENSMPUT00000008549
Sequence length 1011
Comment pep:novel scaffold:MusPutFur1.0:GL897291.1:302469:316133:-1 gene:ENSMPUG00000008478 transcript:ENSMPUT00000008549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGAARSGSRVAGMVCSLWVLVLGSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACASLGVA
GGTCRETFTLYYRQAEEPDGPDSVSAWHLKRWTKVDTIAADESFPASSAWAVAHGAGQRA
GLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFAYTCPSVLRAFASFPETQASGA
GGASLVAAVGTCVAHAEPEEDGGGGQAGGSPPRLHCNGEGKWMVAVGGCRCRPGHQPARG
DKACQACPEGSYKALAGNTPCLPCPARSHAPSAAAPVCPCLEGFYRASSDPPETPCTGPP
SAPRELWFEVQGSVLMLHWRLPQELGGRGDLLFNVVCKECGGHRDPGSGTGGACRRCRDE
VHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHAVPSA
VPALHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQL
SPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSTQLPERLSLVIGSILGALAFLLLA
AITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIREFTREVDPAYI
KIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLQMTFLGQAAVLGQFQHPN
ILRLEGVVTKSRPLMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFA
FVHRALSAHSVLVNSHLVCKVARLGHSPQGPSCMLRWAAPEVIAHGKHTTSSDVWSFGIV
MWEVMSYGERPYWDMSDQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRTQRPHFDH
LVAAFDKMIRKPDTLQADGGPGDRPSQALLNPVALDFPSLDSPQAWLSAIGLECYRDNFS
KFGLCTFSDVAQLNLEDLPALGITLAGHQKKLLHNIQLLQQHLRELGSVEV
Download sequence
Identical sequences M3YAQ7
XP_004781476.1.14098 XP_004781477.1.14098 XP_012905905.1.14098 ENSMPUP00000008414 ENSMPUP00000008414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]