SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008663 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008663
Domain Number 1 Region: 342-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-60
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 58-144
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 146-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008663   Gene: ENSMPUG00000008733   Transcript: ENSMPUT00000008805
Sequence length 522
Comment pep:known scaffold:MusPutFur1.0:GL897184.1:885509:904516:-1 gene:ENSMPUG00000008733 transcript:ENSMPUT00000008805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQGLILGLRLCAGCLGRSYVLCWAQGLPPPHVPAGHDEPLGCRAAQVSIPYWNLSGKAM
ASATKKMKEEATCAICLSLMSEPVSISCGHSYCNQCIMSFLENQGPVDTSSNTFPCPHCR
APFRLASLRPNKQLGSLIEAIKEMEHEMSCEEHGEHLHLFCEDESQLICWRCERSPRHKG
HHTALIEDVCQDYKEKLQNAVTNLRQLEEECTKLKLFTTKQISEWNEKIDIEKQKIQSDF
KNLQSFLQEEEKSHLWRLEKEKEQTLKRLRDNEATLEQKSQELRSHILELEEKCQSSAQK
LLQDVKDTLRRSWAMTLERPDAHSLELHAVCSVSELYFDVKKMLRSYQVNVTLDPDTAHR
ELILSEDRRQVTRGCPQENLDNSSKRFSILPCILGCEGFISGKHYFEVDVGEGTGWDLGV
CLDSVHRDVGLMQKPQSGFWAIRLCKKKGYLALTCPITSLSLVEQPLVVGIFLDCDVGLV
SFYNMTTGSHIFTFPKASFSDTVRPYFRVYQHSPLFLPPPDE
Download sequence
Identical sequences M3YBF6
XP_004778815.1.14098 ENSMPUP00000008663 ENSMPUP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]