SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008679 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008679
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 617-681
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.87e-18
Family LIM domain 0.0095
Further Details:      
 
Domain Number 3 Region: 558-621
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.16e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 526-556
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000158
Family LIM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 677-701
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000212
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008679   Gene: ENSMPUG00000008750   Transcript: ENSMPUT00000008822
Sequence length 708
Comment pep:novel scaffold:MusPutFur1.0:GL897014.1:3378479:3435953:1 gene:ENSMPUG00000008750 transcript:ENSMPUT00000008822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQSPLPVIPHQKDPARDTNGSPAAL
SPNPEARASLGTPGTPELRHTFSSFSQTSVFSSHTEASEPGPPRGSPGAKTSLEGALDSF
SPKAPQGSSQPRQYNNPIGLYSAETLREMAQMYQMSLRGKASGAGLPGGSLPIKDLAVDS
ASPVYQAVIKNQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEYMQDPDEEALRRSSTP
IAHAPVCTSQAATPLLPASAQPPAAAPPGAASPPLSAATAHAATASAAAPASSPADSPRP
QASAYSPAKATSPAPATHTYNEASAAPAPKPRVVTTASIRPSVYQPVPVSTYSPSPGGNY
SPAPYTPSPAPTYSPSPAPSYTPSPAPSYNPAPSAAAYSGGPVESASRPPWVSDDSFSQK
FAPGKSTTSISKQTLPRGTPAYTPVGPQVSPLARGIVQRAERFPASSRTPLCGHCNNVIR
GPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCNTKIMG
EVMHALKQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKDYVNLFSTKCHGCDFPVEAG
DKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDRPLCKKHAHAINV
Download sequence
Identical sequences M3YBH2
ENSMPUP00000008679 ENSMPUP00000008679 XP_004765841.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]