SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008804 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008804
Domain Number 1 Region: 318-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.17e-23
Family Intermediate filament protein, coiled coil region 0.0000326
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000356
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008804
Domain Number - Region: 138-235
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008804   Gene: ENSMPUG00000008874   Transcript: ENSMPUT00000008948
Sequence length 457
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:1688407:1696330:1 gene:ENSMPUG00000008874 transcript:ENSMPUT00000008948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSARPAHASIKPSLPRSGQSPASMERRRVASAARRSYASSLDMVGGSLVSGRRLGPGTR
LSLARMPLPLPARVDFSLAGALNTGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKA
LAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTASSARLEVERDNLAQDLGTLRQKLQ
DETNLRLDAENNLATYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVQELQEQLA
RQQVHVELDVAKPDLTAALREIRTQYEAMASSNMHEAEEWYRSKFADLNDAAARNAELLR
QAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHAREAASYQEALARLEEEGQ
SLKDEMARHLQEYQDLLNIKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDT
KSVSEGHLKRNIVVKTVEMRDGEQVIKESKQEHKDVM
Download sequence
Identical sequences M3YBU7
ENSMPUP00000008804 ENSMPUP00000008804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]