SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008868 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008868
Domain Number 1 Region: 581-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 665-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000529
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 252-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000302
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 418-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000755
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 340-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 508-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000399
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 7 Region: 626-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000526
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 710-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000116
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008868
Domain Number - Region: 310-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00176
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 62-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00504
Family Classic zinc finger, C2H2 0.06
Further Details:      
 
Domain Number - Region: 14-47
Classification Level Classification E-value
Superfamily SET domain 0.0311
Family Histone lysine methyltransferases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008868   Gene: ENSMPUG00000008938   Transcript: ENSMPUT00000009012
Sequence length 1022
Comment pep:known scaffold:MusPutFur1.0:GL896984.1:5391260:5431260:-1 gene:ENSMPUG00000008938 transcript:ENSMPUT00000009012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLVRPAAGPEHQNLTAFQHGNDVYFTTSRDIPPGAELRVWYAAFYAKKMDKPMLKQACP
GAHAAGTPESSAAVESEPSQWVCKVCSASFLELQLLNEHLLGHLEQAKSLPPASQHEAAP
EKEPDVPRGGPPAVPKSVSATKEQKKKPRRGRKPKASKPEQPLDIIEGKEPPEPVAEIVT
EVPPDEPVAAAPDDRIMELVLGKLAASPGDTGSVPKFPHHQSTTITLKRSLILSSRHGIR
RKLVRQLGEHRRVYQCSICSKVFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHV
SYKHSRNEVDGEYRYRCGTCEKTFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKH
KKKHGDKKFACEVCSKMFYRKDVMLDHQRRHLEGVRRVKREDLDAGGENLVRYKKEPSGC
PVCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQRE
EFIGKIGISSEENEDNSDTSADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSI
CNRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSH
ACEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKE
CHRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKK
YVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHIRRKHPEVLAVRIDDLDHLPE
TTTIDASSIGIVQPELSLEQEELAEGKHGKAARRAHKRKQKLEAEAAGAPGPEEATFSEY
TEKEPVLSGVGDETDSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAGTQFTS
LQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDIQIHPQPEATNPQSVAHF
INLTTLVNSITPLGSQLGDQHPLTWRAVPQTDVLPPPQPQAPPPQAPPPQVPAEPQPQMY
SY
Download sequence
Identical sequences M3YC11
ENSMPUP00000008868 ENSMPUP00000008868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]