SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008982 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008982
Domain Number 1 Region: 942-1045
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-27
Family PDZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 545-651
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-26
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 439-544
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-24
Family Second domain of FERM 0.00077
Further Details:      
 
Domain Number 4 Region: 759-864
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-23
Family PDZ domain 0.0096
Further Details:      
 
Domain Number 5 Region: 1077-1180
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-21
Family PDZ domain 0.027
Further Details:      
 
Domain Number 6 Region: 345-434
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000558
Family First domain of FERM 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008982
Domain Number - Region: 82-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00369
Family Protein kinases, catalytic subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008982   Gene: ENSMPUG00000009055   Transcript: ENSMPUT00000009130
Sequence length 1316
Comment pep:novel scaffold:MusPutFur1.0:GL897014.1:4568783:4642170:-1 gene:ENSMPUG00000009055 transcript:ENSMPUT00000009130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCHIRVIAGMSPASVTLASALQVRGEALSEEEIWSLLSLAAERLLEDLRKDSSDYVVCPW
SALLSAAGSLSFQDHISPIAAVPFKAPELLQGQSDEELSDASQMHVYSLGMTLYWSAGFH
VPQDQPLRLHEPLHSILLTMCEDQPHRRLPLQSVLEACRVHREEVAVYPASANLHVQRLA
GLVLGTISEVGRGAAEGSYSVQWDRSRLIRSRLHQVSCESPAAGTLERPHPCRVSERSTE
TQSSLEPGPSTSVPSHCSLSASSALPMEAPPELEDGQQLSSGSMFPVSAETSQSAIPSQR
AFLQRKGKFSRPEFILLAGEVPVTLHLPGSVVTKKGKSYLALRDLCVVLLSGQRLEVKCD
IMSTAGAVFSAVMSFVHLGELTYFGLAYMKGKEFFFLDNETRLCKIAPKGWSEQPQKKTF
SNTFTLFLRIKFFVSCCLQLQHSQTRHQFYLQLRKDILEEKLYCNDETLLQLAVLALQAE
FGNYPEEQIESKTYFRVEDYLPASLLERMTALRVQAEVSERHRVSPVLWGEDAELEFLRV
TQQLPEYGVLVHRVLPEKARVEGEMALGICTKGVIVYEVTNNSRIATLRFQWREIRKIST
CRKKFTITSSITGKKHTFVTDSAKTCKYLLRLCSAQHGFNAQMSSLPVAAVISDHDKCVQ
MPSMSLAHLAQSKSLTWIQRLSSSENALFAPAPRLEAAAGGLLAASMDNFTVKNSKETAA
RGNRGSPCMRREQLETISLIQKSTTRDPVSGLPVESMYMVGPQNDRRKGFIAEPEGEITH
VTLTRDPHRGFGFVINEGDGVGKADPGIFISSIIPGGPADKAKKIKPGGRILALNHISLE
GFTFDMAVRMIQNSPDSIELIISQSKGFCGSTPSEEKNSMANSGVLSTDSPSNWHQGSFS
SHKQNQEKNIEDLEVAQTQSLLPRVRPQLSPSPLKGQGTGSSYPPPPSEINVSEIYFVKL
VKEDGTLGFSVTGGINTSVPYGGIYVKAIVPGGPAAKEGQILRGDRLLQVDGVSLCGLTH
KQAVCCLKGCGQVARLVLERRGPRTAQQCPSAKDRTGDECTAVSLATVLPGRPEGCVSAT
DGPKFEVTLKKNASGLGFSFVQMERESCSHLKNDLVRIKRLFPGQPAEENGAIAAGDIIL
AVNGRPIEGLVFQEVLHLLRGASQEVTLLLCRPPPGVLPEVDQGWQTPVLSSDKEFTKAS
CTDSEQSPSLDQEDSRRDSASPDAGESLSLRPESFQKAPGEAQGDQDLERPWTTCLTHPQ
DSHPHLCRLQQEMDASTLATSLEKDMRQNCYSVCDIKRLERFSSSSSLTGLSTDIS
Download sequence
Identical sequences M3YCC5
ENSMPUP00000008982 ENSMPUP00000008982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]