SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009209 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009209
Domain Number 1 Region: 162-226
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009209   Gene: ENSMPUG00000009284   Transcript: ENSMPUT00000009362
Sequence length 689
Comment pep:known scaffold:MusPutFur1.0:GL897058.1:3118285:3174818:-1 gene:ENSMPUG00000009284 transcript:ENSMPUT00000009362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARRHRHPLQALQRRSQELKLQVDSLLSESRLKGVLDSSKRRDIYQRCVQLKQAIDENK
NALQKLNKADEPAPVGNYNQKKEEEHNLLDKLTHQLQELAVSISRENITEIKTPSEREED
DDSADEDEEAEKEEEDDEEEESEGSGGEEEETEEEEKQENESHSQTSKEYIAVGDFAAQQ
AGDLTFKKGEILLIIEKKPDGWWIAKNAKGNKGLIPRTYVEPYNKEGGQDSSEEGSEEDV
EVEDQTAEGEEVKQRTDSHWSAVRKAISEQINTVDVLTTMGAIPAGFRPSTLFQLLEEGN
QFRASYFLQPELTPSQLAFRDLMWDAKTGTIRSRPSRVSFILTLWSCKMIPLPGMSIQVL
SRHVRLCLFDGNKVLSNIHTVRATWLPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSSP
DLGILFELGISYIRNSTGERGELSCGWVFLKLFDASGIPIPAKTYELFLNGGTPYEKGVE
VDPSISRRAHGSVFHQMMTMRRQPQLLVKLRSLNRRSRDLLSLLPETLIGSMCSIHLLIF
YRQILGDVLLKDRMTMQSADLISNPVLATFPKLLEQPDIMDALRSSWAEKESTLKRSEKR
DREFLKATFLLVYHDCVIPLLHSTLLPPFRWAEEETEAARWKVITDFLKQNQENEGALQA
LLSPDGVHEPFDISEQTYDFLGEIRKNAA
Download sequence
Identical sequences M3YD02
XP_004771017.1.14098 XP_012900465.1.14098 ENSMPUP00000009209 ENSMPUP00000009209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]