SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009234 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009234
Domain Number 1 Region: 1838-2005
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.11e-16
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009234
Domain Number - Region: 408-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0834
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009234   Gene: ENSMPUG00000009308   Transcript: ENSMPUT00000009387
Sequence length 2150
Comment pep:known scaffold:MusPutFur1.0:GL896900.1:38184568:38261331:-1 gene:ENSMPUG00000009308 transcript:ENSMPUT00000009387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPNWGRYGGGRHHPPPPGPPPPPPPPVALPEASPGPGYSSSTTPAAPSSSGFMSFREQH
LAQLQQLQQMHQKQMQCVLQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSY
QKQQQYKHQMLHHQRDGSPGLVPMELDSPPESPPVPPGSYMPPSQSYMPPPQPPPSYYPP
ASSQPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSSQSYLSHSQSYLPSSQASPSRPSQ
GHSKSQLLAPPPPSAPSGNKTAVQQEPLESGAKNKSAEQQAAPEPDPSTMTPQEQQQYWY
RQHLLSLQQRTKVHLPGHKKGPVIAKDAPEPVKEEVTVPAASQAPEPSSSDEPPLPPPNE
EVPPPLPPEEPQSEDPEEDARLKQLQAAAAHWQQHQQHRVGFQYQGIMQKHTQLQQILQQ
YQQIIQQPPHMQTMSVDVQLRHYEMQQQQFQHLYQEWEREFQLWEEQLHSYPHKDQLQEY
EKQWKTWQGHMKATQTYLQEKVNSFQNMKNQYMGNMSMPPPFVPYSQMPPPLPTMPPPVL
PPSLPPPVMPPALPASVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSS
AGPPPVLPPPSLSSTAPPPVLPLPPLSLATPPPGLPPPGVPQGMPPQLGSAPVPPASTSQ
SSQVPEKPRPALLPTPVSFGSGPPSAYHPPLQSAVSPSEQMNSKTLSKSTLPYSSFSSEQ
GLGESSAAPSQPITGVKDMPVRSGGLLPDPPRSSYLEGPRGPRFDGPRRFEDLGSRCEGP
RPKGPRFEGNRPDGPRPRYEGHPPEGTKSKWGMIPRGPASQFYITPNTSLSPRQSGPQWK
GPKPAFGQQHQQQPKSQAEPLSGNKEQLADTNSNQQKNFKMQSATFSIAADVKDTKAAQS
NENLSDSQQEPPKSEVSEGPIEPSDWDQNSQSMETQMDKAQAVTQPVSLANKPLPSQSAF
PSKPGGMEGGAAVTTSSSLTADNDFKPLGIGLPHSENSQEKGLPRPDNRDNRLEGNRGSS
SSYRGPGQSRMEDTREKGLVNRGRGQALSRGPGLIKQEDFRDKMMGRREDSREKMNRGEG
SRDRGLMRPGGSREKVPGGLQGSQDRGRAGSRERGLPRRAGSQERGPPRRAGSRERVPPR
RAGSRERGPPRGPGSRERGLGRPDFVRDRGPFRPEPGDGGEKMYPYHRDEPPRAPWNHGE
ERGHEEFPLDGRNAPMERERLDDWDRERYWRECEHDYQEETLDPYNREDRFSAPPSRSHD
GDRRGPWWDDWERDQDMDEDYNREMDRDLDRDVDRIGRPMDMYDRNLDNEWDRDYGRPLD
EQESQFRERDIPSLPPLPPLPPLPPLDRYRDDRWREERNRDHGYDRDFRDRGELRIREYP
ERGDTWREKRDYIPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDTNLD
SDQGLGGVMVLSQRQHEIILKAAQELKMLREQKEQLQKMKDFGSEPQMPDHLPPQDARLQ
NASSRPGMYPPPGSYRPPPPMGKPPGSIIRPSAPPVRSSVPVTRPPIPIPPPPPPPPPPP
PPPPVIKPQTSAVEQERWDEDSFYGLWDTNDEQGLNSEFKPETGTIPPAPVLPPPHVHPS
IPPPGPLPMGMPPMSKPPPVQQTVDYGHGRDMSTNKVEQIPYGERITLRPDPLPERSTFE
TEHTGQRDRYDRDRDREPYFDRQSNVMADHRDFKRDRETHRDRDRDRGVIDYDRDRFDRE
RRPRDDRTQSYRDKKDHSSSRRGGFDRPSYDRKSDRPAYEGPSMFGGERRTYPEERMPLP
APSLSHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRD
KEVEFGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKT
FKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRK
LKEINKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEEQKEEKKDAEEEESE
LGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRDWEAIASRMEDYLQLPDDYDTRASEPGK
KRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI
Download sequence
Identical sequences M3YD27
ENSMPUP00000009234 ENSMPUP00000009234 XP_004739315.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]