SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009299 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009299
Domain Number 1 Region: 614-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-84
Family Protein kinases, catalytic subunit 0.000000000319
Further Details:      
 
Domain Number 2 Region: 19-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-76
Family Ephrin receptor ligand binding domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 322-527
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-39
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 4 Region: 908-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.36e-20
Family SAM (sterile alpha motif) domain 0.00018
Further Details:      
 
Domain Number 5 Region: 252-325,360-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000628
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009299   Gene: ENSMPUG00000009374   Transcript: ENSMPUT00000009453
Sequence length 984
Comment pep:novel scaffold:MusPutFur1.0:GL896986.1:4037574:4456072:-1 gene:ENSMPUG00000009374 transcript:ENSMPUT00000009453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDCLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEAENSVACKACPAGMFKASQEAEGCSHCPSNSRSPSEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
RKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAVNGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAG
HQKKILNSIHSMRVQMSQSPTAMA
Download sequence
Identical sequences M3YD92
ENSMPUP00000009299 ENSMPUP00000009299 XP_004762519.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]