SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009878 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009878
Domain Number 1 Region: 90-264
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.1e-62
Family Cyclophilin (peptidylprolyl isomerase) 0.00000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009878   Gene: ENSMPUG00000009953   Transcript: ENSMPUT00000010038
Sequence length 266
Comment pep:known scaffold:MusPutFur1.0:GL896937.1:4128135:4160931:-1 gene:ENSMPUG00000009953 transcript:ENSMPUT00000010038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALKTNYPSKFEDPIIVPLQEFAWDQYLQEKKKELKNEIWEYSSYVMCFVNDQLLGDAFDL
QKWAQKMWDIVDFKPPELYEALTVDYAAKFLTHTKHAFVFLDISIDFYPIGRLVFELYCD
SCPKTCRNFQVLCTGKAEFSQSGIRLHYVGSIFHRVVPNGWIQGGDIVEGRGDDGVSIYG
PTFEDENFSIPHNKRGVLGMANKGRHTNGSQFYITLQPAPYLDRKYVAFGQLVEGTEVLQ
KLELVPTENERPIQQCVIIDSGDLYA
Download sequence
Identical sequences M3YEX1
ENSMPUP00000009878 ENSMPUP00000009878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]