SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009881 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009881
Domain Number 1 Region: 135-280
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-32
Family AlaX-like 0.022
Further Details:      
 
Domain Number 2 Region: 37-133
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000102
Family AlaX-M N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009881   Gene: ENSMPUG00000009956   Transcript: ENSMPUT00000010041
Sequence length 449
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:3164212:3179792:1 gene:ENSMPUG00000009956 transcript:ENSMPUT00000010041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWIRDAPAVKIVPRGSPSASRRSSVCNFPRPRETVAMAFRCQRDSYAREFTTTVVSCSP
AELQTEGSNGKKEVLNGFHVVLEDTLLFPEGGGQPDDRGSINDVSVLRVTRQGAQADHFT
QTPLAPGTEVQVRVDWERRFDHMQQHSGQHLITAVADHLFGLKTTSWELGRARSVIELDS
PSVTAEQVAAIEQSVNEKIRARLPVNVRELSLDDPEVEQVRGRGLPDDHAGPVRVVTIES
VDANMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLAFLAGNRVLKWMERSHGSEKALTAL
LKCGAEDHVEAVKKLQNSTKLLQKNNLNLLRDLAVHVAHSLRNSPDWGGVVTLHRKEGDS
EFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPAEAVETLGPRVAEVLEGKGAGKKGR
FQGKATRMSRRGEVQALLQDYISTQSAEE
Download sequence
Identical sequences M3YEX4
ENSMPUP00000009881 ENSMPUP00000009881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]