SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009937 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009937
Domain Number 1 Region: 290-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-43
Family SPRY domain 0.0000438
Further Details:      
 
Domain Number 2 Region: 8-89
Classification Level Classification E-value
Superfamily RING/U-box 1.57e-22
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 84-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.48e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009937   Gene: ENSMPUG00000010012   Transcript: ENSMPUT00000010097
Sequence length 494
Comment pep:known scaffold:MusPutFur1.0:GL897188.1:852954:867862:-1 gene:ENSMPUG00000010012 transcript:ENSMPUT00000010097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFPAQMNIQMEVTCPICLDLLTMPLSLDCGHSFCQACITAKGQDSGVHQGGESNCPVCQ
CKYQFWNLRPNQPLANIVKKVKENMSPWQKKLCEHHGEKLLIFCKEDGKLICQHCAQSLE
HSGHQIFFMEKVAKNYQEKLQAALKKLRKEQPKMEELEATIREEKASWKNHMQTERQRIL
KGFNDMRATLDSEEKRVLQKLEEDEVNVLDNLVVARDQLAQQKQCLRELISDIEHQIWGS
SVDTVQDMINVMKRSERWTLKKPNIVSKKLKSTFRIPDLSGMLQVFKELTEVQCYWVDVL
LKPVNAISNIAISADKRQMTTVHNFSLKNVFICDFSAFDVLGYQHFSSGKYYWEVDVSEK
IAWILGVYSKARNLKRKESSGFVFDPNVNRPDVYSRYKPQFGYWVIGLQNESEYKVFEET
STSDPRILTLFIPVPPCRIGVFLDYEARVVSFFNVTNHGSLIYRFSNCQFSHAAYPYFNP
WNCQRPITLCPPSS
Download sequence
Identical sequences M3YF30
ENSMPUP00000009937 XP_004779051.1.14098 ENSMPUP00000009937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]