SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010124 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010124
Domain Number 1 Region: 412-736
Classification Level Classification E-value
Superfamily DNase I-like 3.8e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 25-124
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-26
Family SH2 domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1202-1262
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000426
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010124   Gene: ENSMPUG00000010200   Transcript: ENSMPUT00000010286
Sequence length 1264
Comment pep:novel scaffold:MusPutFur1.0:GL897030.1:4269130:4285103:-1 gene:ENSMPUG00000010200 transcript:ENSMPUT00000010286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAACGAPGPGGAGPGGALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGA
FALCVLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLL
PVEREREPDPPDDRDVSDGEDEKPPLPPRSGSTSMSASVGPGSPPAASETPTTAAAESAP
NGLSTVSHEYLKGSYGLDLEAVRGGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKV
FDQQSSPMVTRLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPP
APLQPSIRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQE
DWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNK
HSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQEN
SVGDREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGI
ANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFD
ISLRFTHLFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEE
ISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIV
TSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCL
EEYKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESY
GECVVALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKD
EAGAKSKVPSVSRGSQDPRSGNRKPAPSEASCPLSKLFEEPEKPPPTGRPPAPPRAAPRE
EPLTSRLKAEGAPEPEGVAAPPPKNSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPSATK
NKVAITVPAPQLGRHRHPRVGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPG
PVVRGRSGGEARGPPPPKAHPRPPLPPGPSPTSTFLGEVASGDDRSCSVLQMAKTLSEVD
YAPAGPGRSVLLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRAG
GLGEAGMGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTL
QLSK
Download sequence
Identical sequences M3YFL7
ENSMPUP00000010124 ENSMPUP00000010124 XP_004768191.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]