SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010167 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010167
Domain Number 1 Region: 17-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000276
Further Details:      
 
Domain Number 2 Region: 367-480
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.68e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000681
Further Details:      
 
Domain Number 3 Region: 187-359
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.35e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010167   Gene: ENSMPUG00000010242   Transcript: ENSMPUT00000010329
Sequence length 481
Comment pep:novel scaffold:MusPutFur1.0:GL896962.1:8339116:8386118:1 gene:ENSMPUG00000010242 transcript:ENSMPUT00000010329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEPQPQRPPPAAGVVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGC
VPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRIIKEKRDAYVSRLNTIYQNNLTKSHI
EIIHGHAAFTSDPEPTVEVNGNKYTAPHILIATGGVPSRPQESQIPGASLGITSDGFFQL
EELPGRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRNFDSIISSNCTEELENSGI
EVLKYSQVSKVKVIRLAKAILSLELHPLSDGPIKYSNKFSISTLFLLTWEFIQRIPNLFG
FLKIKMGIQTDDKGHIIVDEFQNTSVRGIYAVGDVCGKALLTPVAIAAGRKLAHRLFECK
EDSKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTTFTPMYHAVTKRKTKC
VMKMVCATAEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTL
R
Download sequence
Identical sequences M3YFR0
ENSMPUP00000010167 ENSMPUP00000010167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]