SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010210 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010210
Domain Number 1 Region: 225-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-82
Family Protein kinases, catalytic subunit 0.0000000626
Further Details:      
 
Domain Number 2 Region: 121-264
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-40
Family SH2 domain 0.000049
Further Details:      
 
Domain Number 3 Region: 38-170
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-24
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010210   Gene: ENSMPUG00000010284   Transcript: ENSMPUT00000010372
Sequence length 515
Comment pep:novel scaffold:MusPutFur1.0:GL896937.1:9659435:9760167:-1 gene:ENSMPUG00000010284 transcript:ENSMPUT00000010372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVCLRFWAYLRPCLPCLFQEADKPGVVIENPMARCSPGPPQLQSQEPGRSHGHYFVAL
FDYQARTAEDLSFRTGDKLQVLDTSREGWWFARHLEKRGDGSGQPLQGYIPSNYVAEDRS
LQAEPWFFGAIKRTDAEKQLLYSENQTGAFLIRESESQKGDFALSVLDERAVKHYRIRRL
DEGAFFLTQRRTFSTLNEFVSYYTKTSDGLCVQLGKPCLKIQVPVPFDLSYKTADQWEID
RKSIQLLKRLGSGQFGEVWEGLWNNTTSVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLI
QLYAVCTLEDPIYIITELMRHGSLQEYLQNDAGTKIHLPQQVDMAAQVASGMAYLESQNY
IHRDLAARNVLVGEHNIYKVADFGLARVFKVGNEDIYESKHEIKLPVKWTAPEAIRANKF
SIKSDVWSFGILLYEIITYGKMPYTGMTGAQVIQILGQNYRLPQPPNCPPQFYNIMWECW
NADPKERPTFEKLHWKLEDYFETDFSFSDTNNFVR
Download sequence
Identical sequences M3YFV3
XP_004753602.1.14098 ENSMPUP00000010210 ENSMPUP00000010210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]