SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010212 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010212
Domain Number - Region: 100-126
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0585
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010212   Gene: ENSMPUG00000010286   Transcript: ENSMPUT00000010374
Sequence length 133
Comment pep:novel scaffold:MusPutFur1.0:GL897010.1:5484565:5503357:1 gene:ENSMPUG00000010286 transcript:ENSMPUT00000010374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTAKETVNKTKRQSTEWEKIFANDSTDKRLISRIYNELLKLNTHKIDNHIKKWAEDMNR
HFSNEDIQIAIRHMKKCSSSLAIREIQIKTTLRYHLTPGECISPSNKEQLLHEFWICKFC
QSVREGRLTSLWD
Download sequence
Identical sequences M3YFV5
ENSMPUP00000010212 ENSMPUP00000010212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]