SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010230 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010230
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.74e-72
Family IMD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010230   Gene: ENSMPUG00000010304   Transcript: ENSMPUT00000010392
Sequence length 741
Comment pep:known scaffold:MusPutFur1.0:GL896939.1:12706592:12725227:-1 gene:ENSMPUG00000010304 transcript:ENSMPUT00000010392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKV
ADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQ
LDKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEE
TEKQAVRRALIEERGRFCTFIAFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPP
ASEQVIKDLKGSDYSWSYQTPPSSPGGSGSRKSSMCSTPSSSSGAKGGGAPWPGGAQTYS
PSSTCRYRSLAQPATAAARLSSVSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSE
ASETCQSVSECSSPTSDWAKAGPHEQTSGTSLQRRKDRVEHPRDTEPGLASGGALGPSGE
EAPRPRMSPATIAAKHGEEVSPAASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTP
SCSEDTIPSQGSDYDCYSVNGDADGEGPAEFDKSSTIPRNSNIAQNYRRLIQTKRPASTA
GLPSASGAPPGVATIRRTPSTKPAVRRALSSAGPIPIRPPIVPVKTPTVPDSPGYTGPMR
AGSEECVFYSDEAASPLAADLAKASPKRLSLPNTAWASPAPEAAGYPGLAADDDDEQQQL
AANRHSLVEKLGELVAGAHALGEGQFPFPTALASAAAPTETPSPPPAASGDPPAEDMLVA
IRRGVRLRRTVTNDRSAPRIL
Download sequence
Identical sequences M3YFX3
ENSMPUP00000010230 ENSMPUP00000010230 XP_004754093.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]