SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010405 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010405
Domain Number 1 Region: 417-549
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-32
Family DEP domain 0.0000219
Further Details:      
 
Domain Number 2 Region: 11-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-24
Family DIX domain 0.0019
Further Details:      
 
Domain Number 3 Region: 243-355
Classification Level Classification E-value
Superfamily PDZ domain-like 3.33e-23
Family PDZ domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010405   Gene: ENSMPUG00000010482   Transcript: ENSMPUT00000010573
Sequence length 734
Comment pep:novel scaffold:MusPutFur1.0:GL896973.1:6914126:6920776:1 gene:ENSMPUG00000010482 transcript:ENSMPUT00000010573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSGAGGGGGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMD
QDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRIELAPPPAPLPPVP
PERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPSG
PSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRK
QRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMK
GGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQA
YFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTMTSGSSLPEGCEGRGLSVHT
DMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASG
LLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPG
ATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGA
GRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGDPSGADGGPLPSRGSSGGAPNLRAQP
GLHPYAPPPGTALPYNPMMVVVMPPLPPPIPPTVQPPGAPPVRDLGSVPPELTASRQSFH
MAMGNPSEFFVDVM
Download sequence
Identical sequences M3YGE8
XP_004760411.1.14098 ENSMPUP00000010405 ENSMPUP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]