SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010478 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010478
Domain Number 1 Region: 3845-4025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 1577-1712
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 3247-3360
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-30
Family Cadherin 0.0008
Further Details:      
 
Domain Number 4 Region: 3148-3259
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-30
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 1141-1246
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-29
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 3358-3469
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-28
Family Cadherin 0.00067
Further Details:      
 
Domain Number 7 Region: 2831-2939
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 1029-1154
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-27
Family Cadherin 0.0008
Further Details:      
 
Domain Number 9 Region: 2300-2413
Classification Level Classification E-value
Superfamily Cadherin-like 3e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 930-1033
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 146-267
Classification Level Classification E-value
Superfamily Cadherin-like 4e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 1786-1906
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 3046-3154
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 2611-2748
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0035
Further Details:      
 
Domain Number 15 Region: 825-928
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-24
Family Cadherin 0.00067
Further Details:      
 
Domain Number 16 Region: 1477-1581
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-23
Family Cadherin 0.00077
Further Details:      
 
Domain Number 17 Region: 466-568
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-23
Family Cadherin 0.00087
Further Details:      
 
Domain Number 18 Region: 2095-2203
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 19 Region: 2940-3045
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 20 Region: 733-823
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 21 Region: 1689-1792
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 22 Region: 2513-2623
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-21
Family Cadherin 0.0041
Further Details:      
 
Domain Number 23 Region: 3457-3573
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 24 Region: 1242-1356
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 25 Region: 2410-2510
Classification Level Classification E-value
Superfamily Cadherin-like 5e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 26 Region: 2203-2310
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 27 Region: 1894-2017
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 28 Region: 2003-2107
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 571-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000757
Family Cadherin 0.0024
Further Details:      
 
Domain Number 30 Region: 2728-2837
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000143
Family Cadherin 0.0035
Further Details:      
 
Domain Number 31 Region: 1361-1483
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.0084
Further Details:      
 
Domain Number 32 Region: 375-472
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000685
Family Cadherin 0.0074
Further Details:      
 
Domain Number 33 Region: 3571-3660
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000343
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 4121-4158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000011
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 35 Region: 4083-4125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.019
Further Details:      
 
Domain Number 36 Region: 4046-4084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 37 Region: 42-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.006
Further Details:      
 
Domain Number 38 Region: 270-375
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000785
Family Cadherin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010478   Gene: ENSMPUG00000010556   Transcript: ENSMPUT00000010647
Sequence length 4612
Comment pep:novel scaffold:MusPutFur1.0:GL896995.1:6103093:6611092:1 gene:ENSMPUG00000010556 transcript:ENSMPUT00000010647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDITMGYCVGTRPPPSCLILLLLKLLATVSQGLPGTGPLGFHFTHPVYNATVCENSAART
YVHSQGRMGITLIDLSWDVKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNRE
IQDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQV
TATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKL
YGNNGVSSTAKLYVHIERVNEHAPTLHVVTHVPFSLDKEPTYAVVTVDDLDEGANGEIES
VSIVAGDPLDQFFLAKEGRWMNEYKIKERKKVDWGSFPYGYNLTLQAKDKGSPQKFSAAK
IIHIANPQRDTVPVRFEKETYDVSISEFSPPGVVVAIVKLSPEPLDVEYKLSPGEDAQYF
KINPRSGLIVTAQPLNTVKKEVYKLGVTNKEGDLKAQVTVGIEDANDHTPEFQQVLYDAF
VNESVPVGTSVLMVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSP
ETYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAV
SAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLMSSGIKNGNFALRITATDGEH
FADPMSVNISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSVNR
QGPHFDKSFPSDVAVKENLPVGADILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMET
GQLKVLLPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPIFLQDSYSVNI
LESSSIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANY
SLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLET
HDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVS
LSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVAAQDDDSGRDGEIQY
SIRDGSGLGRFNIDDESGVISTADILDRETTGSYWLTVYATDRGVVPLYSTIEVYIEIED
VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINT
KTGLITTTSRKLDREQQAEHFLEVTVTDGGSSPKQSTIWVVVQVLDENDNKPQFPEKVYQ
IKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFT
AGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEI
VGVVSVQPANTPLWFDIVGGKHAREMFYILQTACGQNCSTEGGNFDSSFDAEKGVGTIVI
AKPLDAEQRSVYNMSVEVTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDT
EILQIEATDRDEKHKLSYTVHSSIDSASMRKFRIDPSTGVLYTAERLDHEAQDKHILNIM
VRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGE
NAELIYTIEAGNTGNTFKIEPVLGIITVSKEPDMTTTGQFVLSVKVTDQGSPPMSATAIV
RISVTMSDNSHPKFTHKDYQAEVNENVDIGTSVILIAAISQSTLIYEVKDGNVDGIFTIN
PYSGVITTRKALDYERTSSYQLIVQATNMAGMASNATVNIQIVDENDNAPVFLFSEYSGS
LSEAAPVNSIVRSSDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIA
NLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVMDVNDNPPVFTQAVFETVLLLPTY
VGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYMLIAKV
SDGKFYSTSMVTILVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAIGNRLNEPLKY
SILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDI
NDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGANGEVTYVLQDDYGHFEINPNSG
NVILKEAFNSDLSNIEYEVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNE
DIRMDTPILSINATSPEGQGIIYIIIDGDLYKQFNIDFDTGVLKVVSPLDYEITSVYKLT
VRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSTDADSE
NNKMVHYQIVQDTYNSTDYFHIDSASGLILTARMLDHESVQHCILKVRATDNGFPSLSSE
VLVHIYISDINDNPPIFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGN
DRTSFLMDSKSGIITLSNHRKQRMEPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPTFS
QSTYVAEVRENAAAGTKVIHVRATDGDPGPYGQISYAIINDFAKDRFLIDSNGQVITTER
LDRENPLEGDISIFLRALDGGGRTTFCTVRVIVVDENDNAPQFMTLEYRASVRADVGRGH
LVTQVQAMDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKSTVLSFF
VKAVDGGIPVKHSLIPVYIHVLPPETPLPSFTQSQYSFTVSEDTAIGSTVDTLRILPSQN
VRFSTVNGERPENNKAGVFIIEQETGTIKVDKRLDHEVSPAFHFKVAATIPLDKVDIVFT
VDVDIKVLDLNDNKPVFETSSYETIIMEGMPVGTRLTQVRAIDVDWGANGQVTYSLHSDS
QPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDI
NDNAPVFAHEVYRGNVKESDPPGEVVAVLSTWDRDTSDINRQVSYHITGGNPRGRFALGL
VQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVTVSDVNDNSPVCDQVAYTAL
FPEDIPSNKIILKVSAKDADIGSNGDIQYSLYGSGNDEFFLDPESGELKTLALLDRERVP
MYSLTARATDGGGRFCQSDIHLILEDVNDNPPVFSSDHYNACVYENTATKALLTRVQAVD
PDVGINRKVVYSLADSANGFFSIDSSSGIIILEQPLDREQQPSYNISVQATDQSPGQALS
SLATVTITVLDINDNPPVFERRDYLVSVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRS
GNEQGRFRINPKTGGISVSEVLDYELCKKFFLVVEAKDGGTPALSAVATVSINLTDVNDN
PPRFSQDVYSAVISEDALVGDSVILLVAEDADSQPNGQIRFSIVNGDRDNEFAVEPVLGL
VKVKKKLDRERVSGYSLLVQAIDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQE
NKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPHGILRSAVVFQHTGSPEY
VLCVQAKDSGKPQQVSHSYIRVRVIEESIHKPTAIPLEIYIVTMEDDFPGGVIGKIHATD
QDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHV
EQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRTLRNAVLTQKQDSLRIISIQPVAGTT
QLDMLFAVEMHSSEFYKPAYLIQKLSNARRHLENVMRISAILEKNCSGLDCQEQHCQQGL
SLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLCPGSNDPCMEKPCPADMQCVGYEASR
RPYLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKEEDFRLALRLRTLQSNGIIMYT
RANPCIILKIVDGKLWFQLDCGNGPGILGISGRAVNDGSWHSVFLELNRNFTSLSLDDSY
VERRRAPLYFQTLSTESTIYFGALVQADNIRSLTDARVTQVLSGFQGCLDSVVLNNNELP
LQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQHGGSCSGLPSGGYQCTCLSQFTGRNC
ESEITACFPNPCQNGGSCDPIGNTFICNCKAGLTGVTCEEDVNECEREECENGGSCVNVF
GSFVCNCTPGYVGQYCGLRPVVVPNIQAGHSYVGKEELIGIAVVLFVIFILVILFIVFRK
KVFRKNYSRNNITLVQDPATAALLNKSNGIPFRNLRGSGDGRNVYQEVGPPQVPVRPMAY
TPCFQSDSRSNLDKIVDGLGGEHQEMTTFHPESPRILTARRGVVVCSVAPNLPAVSPCRS
DCDSIRKNGWDAGTDNKGVDDPGEVTCFAGSNKGSNSEVQSLSSFQSDSGDDNASIVTVI
QLVNNVVDTIENEVSIMDQGQNYNRAYHWDTSDWMPGARLSDIEEVPNYENQEGGSAQQG
STRELESDYYLGGYDIDNEYPPPQEEEFLNQDQLPPPLPEDFPDQYEALPPSQPVSLAST
LSPDCRRRPQFHPSQYLPPHPFPNDTDLVGPPAACEFSTFAVGMNQGAETAGPADNPSLS
LHNSRGTSSSDVSASCGFDDSEAAMSDYESVGELSLASLHIPFLETQHQTQV
Download sequence
Identical sequences M3YGM1
XP_004763628.1.14098 XP_012917368.1.14098 ENSMPUP00000010478 ENSMPUP00000010478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]