SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010703 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010703
Domain Number 1 Region: 89-204
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010703   Gene: ENSMPUG00000010791   Transcript: ENSMPUT00000010882
Sequence length 312
Comment pep:novel scaffold:MusPutFur1.0:GL896961.1:5027029:5116515:-1 gene:ENSMPUG00000010791 transcript:ENSMPUT00000010882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGFRRKVKAKSKEAAQLVKVEQVGAGGGGLPAPPPPTRKLVFYTQLAHGSATGRVENF
TSIQELYAKIAGVFGISASEILYCTLNTPKVDMENLLGSYVGLEDFIFAHVKGNQKEVNV
YKSEDSLGLTITENGAGYAFIKRIKDGSLIDAVKTICVGDHIESINGENITGWRHYDVAK
KLKELKKGESFTLKLIEPKKAFEVEPRSKAGKSSEKIGTGRETLRLRSKGSASMEDMPSE
TKTKAIEKIDDLLELYMGIQDIDLATTMFEAGKDKGNPDEFAVALDETLGDFAFPDEFVF
DVWGVIGDAKRE
Download sequence
Identical sequences M3YH96
XP_004758195.1.14098 ENSMPUP00000010703 ENSMPUP00000010703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]