SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010874 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010874
Domain Number 1 Region: 241-303
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000207
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 90-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000803
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010874   Gene: ENSMPUG00000010963   Transcript: ENSMPUT00000011056
Sequence length 377
Comment pep:known scaffold:MusPutFur1.0:GL896961.1:7847918:7873856:-1 gene:ENSMPUG00000010963 transcript:ENSMPUT00000011056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWKSDQMFVCKLEEKDVPELAVPTEKCQGLMSEECGRIAALAAGRTRKGAGEEGLVSPE
GAGDEDSCSSSAPLSPSSSPRSMASGSVCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRC
LSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHL
ACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDV
NHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRAR
HKKHVSPNHSSSAPVTAVPPSRLSPPMLEEMVYSAYVPQDGTMLTALHSYMDAHSPTTLG
LQPLLPHSMTQLPISHT
Download sequence
Identical sequences M3YHR7
XP_004758236.1.14098 ENSMPUP00000010874 ENSMPUP00000010874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]