SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010977 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010977
Domain Number 1 Region: 7-160
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000387
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily PDZ domain-like 4.93e-20
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 289-371
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000103
Family PDZ domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010977   Gene: ENSMPUG00000011067   Transcript: ENSMPUT00000011161
Sequence length 380
Comment pep:novel scaffold:MusPutFur1.0:GL896971.1:7644891:7701834:-1 gene:ENSMPUG00000011067 transcript:ENSMPUT00000011161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEV
DLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPG
AQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINT
QEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARS
GKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKY
QLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHM
KTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences M3YI20
ENSMPUP00000010977 ENSMPUP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]