SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010996 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010996
Domain Number 1 Region: 290-417
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-17
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010996
Domain Number - Region: 22-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.0288
Family HR1 repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010996   Gene: ENSMPUG00000011086   Transcript: ENSMPUT00000011180
Sequence length 609
Comment pep:known scaffold:MusPutFur1.0:GL897012.1:3132000:3203790:-1 gene:ENSMPUG00000011086 transcript:ENSMPUT00000011180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQTSRGPELRLAGLPAQQDCSIQEKIDLEIRMREGIWKLLSLSTQKDQILHAVKNLMV
CNARIMAYTSELQKLEEQIANQTGRCDMNFESKERTACKGKIAISDIRIPLMWKDSDHFS
NKERSQQYAIFCLFKMGAEVFDTDMVIVDKTITDLCFENVTIFNKAGPDFQIKVEVYSCC
TEESSITNTPKKLAKKLKTSISKATGKKINLVLQEDHETCSSYSSPIFAAKYNLLAHTTL
TLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMEEN
LISWRRLYCVLRGGKLYCFYSPQEIEAKVEPALVVSINKETRIRAMDKDTKKKIHNFSVI
NPVAGQAVTHIFVADNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFLT
KEATSVYHDMSIDSPVKLESLTDTIQKKLEETNGQFLIGQHEDSSPPLWASLFDGNHQVV
IQKKVLSPASNQLHDGKGKKRRAPLPPSNKAPFSLKTQSNPDQLDKDNWEKTSVSWISPL
DTKLSTLMHHLQKPMAAPRKLLPARKNNVNDDSEHIDTKTNFEAKPVPAPRQKSIKDILD
PRSWLQAQV
Download sequence
Identical sequences M3YI39
ENSMPUP00000010996 XP_004765740.1.14098 ENSMPUP00000010996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]